PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G1416
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family S1Fa-like
Protein Properties Length: 90aa    MW: 10084 Da    PI: 10.1744
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G1416genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA138.11.9e-432590570
         S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                 ++eakGlnPGlivllvv glll+flvgnyily yaqk+lPPrkkkPvskkk+kre+lkqGv++PGe
  Gh_A09G1416 25 ETEAKGLNPGLIVLLVVVGLLLIFLVGNYILYSYAQKTLPPRKKKPVSKKKMKRERLKQGVSAPGE 90
                 689**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190130.0072290No hitNo description
PfamPF046895.5E-412690IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MAEESDFADK VPPSFYEMGN KIIYETEAKG LNPGLIVLLV VVGLLLIFLV GNYILYSYAQ  60
KTLPPRKKKP VSKKKMKRER LKQGVSAPGE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486006.11e-30PREDICTED: DNA-binding protein S1FA-like
SwissprotQ7XLX63e-18S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA0A0D2NTY01e-30A0A0D2NTY0_G
STRINGPOPTR_0016s08890.13e-25(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769